DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and mapk12a

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_571482.1 Gene:mapk12a / 30681 ZFINID:ZDB-GENE-990415-257 Length:363 Species:Danio rerio


Alignment Length:376 Identity:131/376 - (34%)
Similarity:202/376 - (53%) Gaps:52/376 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVL 100
            ||...:..:.:|.||:|.|....|.|.|.:||:|||...|||.:.:||.:|||::|...||:||:
Zfish    21 VPDRYKDLKQVGTGAYGTVCYALDRRTGAKVAIKKLHRPFQSDLFAKRAYRELRLLKHMKHDNVI 85

  Fly   101 SALDILQPP-HLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILH 164
            ..:|:.... .||.|...|::...:.:||.| ::..:.||.:.::..:||:|:||||:|:|.|:|
Zfish    86 GLVDVFTADLSLDRFHNFYLVMPFMGTDLGK-LMKMERLSEERVQYLVYQMLKGLKYIHAAGIIH 149

  Fly   165 RDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSV 229
            ||:|||||.:|..|.|||.||||||..:.:    ||..|||::|||||:::...||:..||:|||
Zfish   150 RDLKPGNLAINEECELKILDFGLARQTDSE----MTGYVVTRWYRAPEVILSWMHYTQTVDIWSV 210

  Fly   230 GCIFGELLGRRILFQAQNPVQQLELITELLGTPTME-DMRHACEGARTHMLRRAPKPPSF--SVL 291
            |||..|:|..:.||:..:.:.||..|.::.|||:.| ..:...|.||.::    .|.|.|  ..|
Zfish   211 GCIMAEMLLGKPLFKGHDHLDQLMEIMKVTGTPSKEFTAKLQSEDARNYV----TKLPRFRKKDL 271

  Fly   292 YTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTA 356
            ..|..:...:|:.:|..||:.||:.||:..:|||.|:..|.|                       
Zfish   272 RILLPNVNPQAIKVLEGMLLLDPESRITAAEALAFPFFSEFR----------------------- 313

  Fly   357 DFEP---SAGQPFD----------DLWERKLTSVQQVKEEMHKFIAEQLQT 394
              ||   :...|:|          :.|:| ||..:.:..:....:||..:|
Zfish   314 --EPEEETEAPPYDHSLDEADQSLEQWKR-LTFTEILTFQPAPAVAESKET 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 129/373 (35%)
mapk12aNP_571482.1 PKc_like 9..351 CDD:304357 128/364 (35%)
S_TKc 25..309 CDD:214567 116/292 (40%)
TXY 181..183 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.