DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and SRPK3

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_055185.2 Gene:SRPK3 / 26576 HGNCID:11402 Length:567 Species:Homo sapiens


Alignment Length:608 Identity:112/608 - (18%)
Similarity:170/608 - (27%) Gaps:322/608 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSMSLVQGGAAGGA------------PQGASAILAAAAPYYQPPAVPQ----------DVQPD-- 43
            :|.|...||.:||:            |:.:.:.||.|.|      |||          :.|.|  
Human     1 MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATP------VPQMLQGLLGSDDEEQEDPK 59

  Fly    44 -----------------------RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVF 85
                                   |.:|:|.|..||...|.:..|.||||.:.:...   .::...
Human    60 DYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGH---YTETAV 121

  Fly    86 RELKML-CFF-------KHENVLSALDILQPPHLDF------FQEIYVITELLQSDLHKIIVSP- 135
            .|:|:| |..       |.|.::..:|       ||      ...:.::.|:|...|.|.|:.. 
Human   122 DEIKLLKCVRDSDPSDPKRETIVQLID-------DFRISGVNGVHVCMVLEVLGHQLLKWIIKSN 179

  Fly   136 -QHLSADHIKVFLYQILRGLKYLHS-ARILHRDIKPGNLLVNSNCV------------------- 179
             |.|....:|..:.|:|.||.|||: .:|:|.||||.|:|:   ||                   
Human   180 YQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILL---CVGDAYIRRLAAEATEWQQAG 241

  Fly   180 ----------------------------------------------------------------L 180
                                                                            |
Human   242 APPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQAEDSGL 306

  Fly   181 KI-----------CDFGLARVE------------------------------------------- 191
            ::           |..|.||..                                           
Human   307 RLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQTSGFSGSLFSPASCSILSGSSN 371

  Fly   192 ------------------------EPDQA-----------------KHMTQEVVTQYYRAPEILM 215
                                    ||..|                 ||.|:::.|:.|||.|:|:
Human   372 QRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLI 436

  Fly   216 GARHYSSAVDVWSVGCIFGELLGRRILFQAQN------PVQQLELITELLGTPTMEDMRHACEGA 274
            || .|....|:||..|:..||.....||:..:      ....:..|.||||     |:       
Human   437 GA-EYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLG-----DI------- 488

  Fly   275 RTHMLRRAPKPPSFSV-----------------LYTLSSHATHEAV---------------HLLC 307
                      ||:|::                 ::.|.....:|.:               ..|.
Human   489 ----------PPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLL 543

  Fly   308 QMLVFDPDKRISVTDALAHPYLD 330
            .|:.:.|:||.|..|.|.||:|:
Human   544 PMMEYIPEKRASAADCLQHPWLN 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 98/550 (18%)
SRPK3NP_055185.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 8/34 (24%)
STKc_SRPK3 68..565 CDD:271120 95/532 (18%)
S_TKc 79..565 CDD:214567 95/521 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..283 0/44 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..351 5/52 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.