DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Mapk9

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001157143.1 Gene:Mapk9 / 26420 MGIID:1346862 Length:423 Species:Mus musculus


Alignment Length:397 Identity:143/397 - (36%)
Similarity:217/397 - (54%) Gaps:57/397 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            :|||.||.|:|.|..|...|..||:|||...||:...:||.:|||.:|....|:|::|.|::..|
Mouse    30 KPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTP 94

  Fly   109 PH-LDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPG 170
            .. |:.||::|::.||:.::|.::|    |:..||  :...|||:|.|:|:||||.|:|||:||.
Mouse    95 QKTLEEFQDVYLVMELMDANLCQVI----HMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPS 155

  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            |::|.|:|.|||.||||||....:..  ||..|||:||||||:::| ..|...||:||||||..|
Mouse   156 NIVVKSDCTLKILDFGLARTACTNFM--MTPYVVTRYYRAPEVILG-MGYKENVDIWSVGCIMAE 217

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPP--SFSVLY---TLS 295
            ::..::||..::.:.|...:.|.||||:.|.|:......|.::..| ||.|  .|..|:   ...
Mouse   218 MVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENR-PKYPGIKFEELFPDWIFP 281

  Fly   296 SHA------THEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY 354
            |.:      |.:|..||.:|||.||||||||.:||.|||:                         
Mouse   282 SESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYI------------------------- 321

  Fly   355 TADFEPSAG-----QPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASS 414
            |..::|:..     |.:|...|.:..::::.||.::|.:.:..:..:..:...|..||..|.|: 
Mouse   322 TVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVKDQPSDAAVSSKAT- 385

  Fly   415 TVAHPSE 421
                ||:
Mouse   386 ----PSQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 139/385 (36%)
Mapk9NP_001157143.1 STKc_JNK 25..360 CDD:270840 136/362 (38%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..423 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.