DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and CILK1

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001362326.1 Gene:CILK1 / 22858 HGNCID:21219 Length:639 Species:Homo sapiens


Alignment Length:395 Identity:123/395 - (31%)
Similarity:184/395 - (46%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDIL-Q 107
            |.:|.|.:|.|........|..:|:||:...|.|......: ||:|.|....|.||:...::: :
Human     8 RQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNL-REVKSLKKLNHANVVKLKEVIRE 71

  Fly   108 PPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADH-IKVFLYQILRGLKYLHSARILHRDIKPGN 171
            ..||      |.|.|.::.:|:::|.....|..:. |:..:||||:||.::|.....|||:||.|
Human    72 NDHL------YFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPEN 130

  Fly   172 LLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGEL 236
            ||.....::||.||||||  |.......|..|.|::|||||:|:.:.:|||.:|||:||||..|:
Human   131 LLCMGPELVKIADFGLAR--EIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEV 193

  Fly   237 LGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHE 301
            ...|.||...:.:..:..|.::||||...|.....:.:.....|.....|  :.|.||..:|:.|
Human   194 YTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVP--NNLKTLIPNASSE 256

  Fly   302 AVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFE------- 359
            ||.||..||.:||.||.:.:.||.:||...|.             ......|...|.|       
Human   257 AVQLLRDMLQWDPKKRPTASQALRYPYFQVGH-------------PLGSTTQNLQDSEKPQKGIL 308

  Fly   360 PSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPSEL-- 422
            ..||.|   .:.:.:...|...:...:..:.|.|..:.||.:   :..:|:..|.| .|||.|  
Human   309 EKAGPP---PYIKPVPPAQPPAKPHTRISSRQHQASQPPLHL---TYPYKAEVSRT-DHPSHLQE 366

  Fly   423 -PPSP 426
             .|||
Human   367 DKPSP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 114/375 (30%)
CILK1NP_001362326.1 STKc_MAK_like 4..284 CDD:270824 100/286 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..344 9/56 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 589..639
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.