DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Mapk4

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_766220.2 Gene:Mapk4 / 225724 MGIID:2444559 Length:583 Species:Mus musculus


Alignment Length:419 Identity:122/419 - (29%)
Similarity:208/419 - (49%) Gaps:88/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            :|:|:|..|:|.:.||.|..|:||:||:  |.....|.|...||:|::....|:|::...::|.|
Mouse    24 QPLGFGVNGLVLSATDSRACRKVAVKKI--VLSDARSMKHALREIKIIRRLDHDNIVKVYEVLGP 86

  Fly   109 PHLDF------FQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDI 167
            ...|.      |...|::.|.:::|| ..::....|:.||.|:|:||:||||||:|||.:||||:
Mouse    87 KGSDLQGELFKFSVAYIVQEYMETDL-ACLLEQGTLTEDHAKLFMYQLLRGLKYIHSANVLHRDL 150

  Fly   168 KPGNLLVNS-NCVLKICDFGLARVEEPDQAK--HMTQEVVTQYYRAPEILMGARHYSSAVDVWSV 229
            ||.|:.::: :.||||.||||||:.:...:.  ::::.:||::||:|.:|:...:|:.|:|:|:.
Mouse   151 KPANIFISTEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAA 215

  Fly   230 GCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAP---------KP 285
            |||..|:|..::||...:.::|::||.:.:.....||        :..:||..|         |.
Mouse   216 GCILAEMLTGKMLFAGAHELEQMQLILDTIPVVREED--------KEELLRVMPSFVSSTWEVKR 272

  Fly   286 PSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAG 350
            |...:|..::|    ||:..|.::|.|:|..|::....|.|||:..     :||           
Mouse   273 PLRKLLPDVNS----EAIDFLEKILTFNPMDRLTAEMGLQHPYMSP-----YSC----------- 317

  Fly   351 MRQYTADFEPSAGQPF------DDL------------WERKLTSV-----------QQVKEEMHK 386
                 .:.||::..||      ||:            |:|...|:           |...|    
Mouse   318 -----PEDEPTSQHPFRIEDEIDDIVLMAASQSQLSNWDRYPVSLSSDLEWRPDRCQDASE---- 373

  Fly   387 FIAEQLQTGRVPLCINPQSAAFKSFASST 415
             :....:.|..||..:.|....|...||:
Mouse   374 -VQRDPRAGSTPLAEDVQVDPRKDSQSSS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 120/413 (29%)
Mapk4NP_766220.2 STKc_MAPK4_6 14..351 CDD:143359 110/362 (30%)
SEG motif 186..188 0/1 (0%)
FRIEDE motif 328..333 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..410 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.