DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Srpk2

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_011248053.1 Gene:Srpk2 / 20817 MGIID:1201408 Length:750 Species:Mus musculus


Alignment Length:219 Identity:59/219 - (26%)
Similarity:84/219 - (38%) Gaps:63/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPGNLLVN-------SNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVD 225
            :..:||||       ....:||.|.|.|....    ||.|:::.|:.||:.|:|:|| .||:..|
Mouse   538 RAADLLVNPLDPRNADKIRVKIADLGNACWVH----KHFTEDIQTRQYRSIEVLIGA-GYSTPAD 597

  Fly   226 VWSVGCIFGELLGRRILFQAQ-------------------------------------NPVQQLE 253
            :||..|:..||.....||:..                                     |....:.
Mouse   598 IWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRDHIA 662

  Fly   254 LITELLG-TPTMEDM--RHACE-----GARTHMLRRAPKPPS-FSVL---YTLSSHATHEAVHLL 306
            ||.|||| .|....|  :::.|     |...|:.:.  ||.| |.||   |........:....|
Mouse   663 LIIELLGKVPRKYAMLGKYSKEFFTRKGELRHITKL--KPWSLFDVLVEKYGWPHEDAAQFTDFL 725

  Fly   307 CQMLVFDPDKRISVTDALAHPYLD 330
            ..||...|:||.|..:.|.||:|:
Mouse   726 IPMLEMVPEKRASAGECLRHPWLN 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 59/219 (27%)
Srpk2XP_011248053.1 STKc_SRPK2 103..>291 CDD:271119
2A1904 <338..418 CDD:273344
PKc_like <537..748 CDD:389743 58/216 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.