DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and kgb-2

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_500384.2 Gene:kgb-2 / 191169 WormBaseID:WBGene00002188 Length:332 Species:Caenorhabditis elegans


Alignment Length:305 Identity:109/305 - (35%)
Similarity:165/305 - (54%) Gaps:24/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP-P 109
            :..||.|:|....|....:|||:||:...|...:|::|.:||..:|...||.|::..|:...| .
 Worm    35 LNVGAQGIVVMADDLVTTQRVAIKKMQQPFLLTMSARRAYREFILLTTLKHPNIIRLLNAFTPDT 99

  Fly   110 HLDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPGNL 172
            .|..|||:|::.|.:..:||::|   ..|..||  :...:||.|..:|:||:...:|||:||.|:
 Worm   100 SLSSFQEVYLVMEFMTHNLHEVI---HRLRLDHETLSFLVYQSLCAIKHLHNLGFIHRDLKPSNI 161

  Fly   173 LVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELL 237
            :||..||||:.||||||....|.  .|:..|.|:||||||:::|. :||..||:||||||..|::
 Worm   162 VVNERCVLKVLDFGLARRRNVDM--RMSDYVGTRYYRAPEVILGL-NYSEKVDIWSVGCILAEMI 223

  Fly   238 GRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPK---------PPSFSVLYT 293
            ...:||..::...|...|:.:|.||. :...:..|......:|..|:         .|..:.|..
 Worm   224 NHTVLFPGKDIRDQWTQISSVLRTPD-DHFINQLEPIGAVYVRSLPQHLARAFNEIVPDSNFLPE 287

  Fly   294 LSSHATHEAVH----LLCQMLVFDPDKRISVTDALAHPY-LDEGR 333
            ..:...|..:|    ||..||..:|::|.||.|||.||| :.:||
 Worm   288 TENPKDHLTLHMARDLLFNMLKINPEERYSVEDALNHPYTMVQGR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 109/305 (36%)
kgb-2NP_500384.2 PKc_like 28..329 CDD:304357 107/300 (36%)
S_TKc 29..326 CDD:214567 105/297 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.