DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and mpk-2

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_494946.2 Gene:mpk-2 / 173880 WormBaseID:WBGene00003402 Length:605 Species:Caenorhabditis elegans


Alignment Length:314 Identity:123/314 - (39%)
Similarity:185/314 - (58%) Gaps:40/314 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDIL--QP 108
            :|.||:|||....|.|:.::||:||:|..|.:...:||..||:::|....|||:::.||:.  :.
 Worm    63 VGAGAYGVVCKAMDTRNKKQVAIKKIPRAFTAHTLAKRSLREVRILRELLHENIIAVLDMFTAEG 127

  Fly   109 PHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLL 173
            .|   .::||::.:|:::|||:|:.|.|.|...|.:.|.||:||||||||||.|:|||:||.|||
 Worm   128 AH---GKDIYLVMDLMETDLHQILHSRQTLMEQHFQYFFYQLLRGLKYLHSAGIIHRDLKPSNLL 189

  Fly   174 VNSNCVLKICDFGLARV--------EEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVG 230
            :|.:|:|:|.|||:||.        ::.:...||||.|.|::|||||||.....|.:.||:||.|
 Worm   190 LNGDCLLRIADFGMARAYASASTVRDDANVGGHMTQYVSTRWYRAPEILFSMVEYDTKVDLWSAG 254

  Fly   231 CIFGELLGRRILFQAQNPVQQLELITELLGTPTME-----------DMRHACEGARTHMLRRAPK 284
            |||.|:|.||.||..::.|.|:::|...||:|..|           |...||.       |:.|.
 Worm   255 CIFAEMLLRRQLFPGKDSVSQIKMIVYYLGSPEEEVINRITSDLVRDSIEACG-------RKTPL 312

  Fly   285 PPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHS 338
            |  ||.::   ..|:.||.:::..:|...|.||.|....|.||::    .:||:
 Worm   313 P--FSAIF---PKASPEARNMVSYLLQISPWKRYSADQILQHPFM----AQYHN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 123/314 (39%)
mpk-2NP_494946.2 PKc_like 54..376 CDD:304357 123/314 (39%)
S_TKc 57..352 CDD:214567 121/303 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.