DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmo and Mapk1

DIOPT Version :9

Sequence 1:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_446294.1 Gene:Mapk1 / 116590 RGDID:70500 Length:358 Species:Rattus norvegicus


Alignment Length:380 Identity:152/380 - (40%)
Similarity:223/380 - (58%) Gaps:43/380 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AILAAAAPYYQPPAVPQDVQPDRP----IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSK 82
            |..|||.|......| .||.|...    ||.||:|:|.:..|..:..|||:||: :.|:.....:
  Rat     2 AAAAAAGPEMVRGQV-FDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQ 64

  Fly    83 RVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFL 147
            |..||:|:|..|:|||::...||::.|.::..:::|::.:|:::||:|:: ..||||.|||..||
  Rat    65 RTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLL-KTQHLSNDHICYFL 128

  Fly   148 YQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEP--DQAKHMTQEVVTQYYRA 210
            |||||||||:|||.:||||:||.|||:|:.|.|||||||||||.:|  |....:|:.|.|::|||
  Rat   129 YQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRA 193

  Fly   211 PEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACE-GA 274
            |||::.::.|:.::|:||||||..|:|..|.:|..::.:.||..|..:||:|:.||:..... .|
  Rat   194 PEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKA 258

  Fly   275 RTHMLRRAPKPPSFSVLYT-LSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHS 338
            |.::|   ..|....|.:. |..:|..:|:.||.:||.|:|.|||.|..|||||||::       
  Rat   259 RNYLL---SLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQ------- 313

  Fly   339 CMCKCCFTTSAGMRQYTADFEPSAGQPF------DDLWERKLTSVQQVKEEMHKF 387
                          .|....||.|..||      |||.:.||..:  :.||..:|
  Rat   314 --------------YYDPSDEPIAEAPFKFDMELDDLPKEKLKEL--IFEETARF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 146/363 (40%)
Mapk1NP_446294.1 STKc_ERK1_2_like 17..351 CDD:270839 145/361 (40%)
Inhibitor-binding 103..109 1/5 (20%)
TXY 183..185 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.