DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and POP4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_009816.1 Gene:POP4 / 852560 SGDID:S000000461 Length:279 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:50/225 - (22%)
Similarity:95/225 - (42%) Gaps:52/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QRCNVNI-NPDHITMLEGTKIKKQHSRKRRAHKSSTLSRREYA-ALGLNTLPTKQMKYE------ 76
            ::..:|: |...::.||....:.:....:|.:|:|.::.|||. ....||....::.||      
Yeast    51 RKSKLNLDNLQKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDK 115

  Fly    77 ---------------EALPLH--------HLWKGYVREHLELREGDEVPQVHDARYDEFSRKLVK 118
                           |:||.:        .||..|::|.|.:.:        :.:....|..|:|
Yeast   116 EDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINYIKELLNITK--------NLKTFNGSLALLK 172

  Fly   119 L---DLHGAKMKVLQSKCSTLENLAGICVMDTKNVLKLLGKDH---RLRTIPKSECVFGMKV--- 174
            |   |.:||.::|.:||..||..|.||.:.|::....::.|.:   .::.|||...||..::   
Yeast   173 LSMADYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPIS 237

  Fly   175 ----GNMEFTIFGQHLNIRPAERSVKKIKN 200
                ..:.::|.|.....|..:|:.:|.|:
Yeast   238 DDDDSALRYSILGDRFKYRSVDRAGRKFKS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 28/103 (27%)
POP4NP_009816.1 UPF0086 172..263 CDD:396440 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4046
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2814
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1167
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.