DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and POP4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001324792.1 Gene:POP4 / 818920 AraportID:AT2G43190 Length:296 Species:Arabidopsis thaliana


Alignment Length:171 Identity:39/171 - (22%)
Similarity:73/171 - (42%) Gaps:32/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LEGTK-IK--------------------KQHSRKRRAHKSSTLSRREYAALGLNTLPTKQMKYEE 77
            |:||| :|                    |:.|:|......|.:|.:.....|...:|....|::.
plant   125 LQGTKSVKLDNYILLDNFVQSRSSASGSKKASQKDSKRSKSRMSMKRLKKSGALHIPKDLQKFDL 189

  Fly    78 ALPLHHLWKGYVREHLELREGDEVPQVHDARYDEFSRKLVKLDLHGAKMKVLQSKCSTLENLAGI 142
            ..|:|.:|:.|:.:.:::           ....:.|..|:..|||||.|.|.:.|.::...:.||
plant   190 FKPMHGMWESYMMKLIKV-----------TGKIQLSLTLLSADLHGAFMFVAECKIASFTGVQGI 243

  Fly   143 CVMDTKNVLKLLGKDHRLRTIPKSECVFGMKVGNMEFTIFG 183
            .|.:|.....::.:|.:.|.:||...||.:::...:.|:.|
plant   244 MVRETSETFGIITRDDKFRVVPKKLSVFIIQLDCWKITLHG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 22/73 (30%)
POP4NP_001324792.1 UPF0086 216..290 CDD:396440 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4046
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362700at2759
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto3565
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.