DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and pop4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001018585.1 Gene:pop4 / 553787 ZFINID:ZDB-GENE-050522-505 Length:219 Species:Danio rerio


Alignment Length:160 Identity:59/160 - (36%)
Similarity:88/160 - (55%) Gaps:9/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KQHSRKRRAHKSSTLSRREYAALGLNTLPTKQMKYEEALPLHHLWKGYVREHLE-LREGDEVPQV 104
            |:..:|.:..|:..|:.:|...|.:..|..:..|||..||||.|||.|:.:... |:.|.. |||
Zfish    61 KRPKKKVKKVKAKGLNAKERRRLQIFQLKPEHQKYELFLPLHELWKSYIEDLCNGLKPGSN-PQV 124

  Fly   105 HDARYDEFSRKLVKLDLHGAKMKVLQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECV 169
                   ..:||:|.|.|||.:.|::|||.:...|.||.|.:.|::.||:.|:.:|:.|||...|
Zfish   125 -------IQQKLLKADFHGAILTVVRSKCPSYVGLTGILVQELKHIFKLITKEDKLKVIPKRNSV 182

  Fly   170 FGMKVGNMEFTIFGQHLNIRPAERSVKKIK 199
            |.::||.....|:|....:|.:|||.||.|
Zfish   183 FSVEVGGFVSHIYGSKFELRSSERSAKKFK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 36/89 (40%)
pop4NP_001018585.1 UPF0086 127..209 CDD:280109 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596525
Domainoid 1 1.000 70 1.000 Domainoid score I9547
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31392
Inparanoid 1 1.050 103 1.000 Inparanoid score I4953
OMA 1 1.010 - - QHG58710
OrthoDB 1 1.010 - - D1362700at2759
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto40703
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.