DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and pop4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001017252.1 Gene:pop4 / 550006 XenbaseID:XB-GENE-1009757 Length:219 Species:Xenopus tropicalis


Alignment Length:155 Identity:57/155 - (36%)
Similarity:88/155 - (56%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RKRRAHKSSTLSRREYAALGLNTLPTKQMKYEEALPLHHLWKGYVREHLELREGDEVPQVHDARY 109
            :||:.:||..|:.:|...:.|..:..:|.:|:..||||.||:.|:|:.......|..||:     
 Frog    65 KKRKRNKSKILTAKERRDMRLFEIKPEQQRYQLFLPLHELWRQYIRDLCNGLRPDAQPQM----- 124

  Fly   110 DEFSRKLVKLDLHGAKMKVLQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECVFGMKV 174
              ...||:|.|||||.:.|.:|||.:...|.||.:.:||:|.|.:.||.:|:|:||..|||.:::
 Frog   125 --IQNKLLKADLHGALLTVAKSKCPSYVGLQGIILQETKHVFKFITKDDKLKTVPKLNCVFSVEI 187

  Fly   175 GNMEFTIFGQHLNIRPAERSVKKIK 199
            ......|:|....:|.:|||.||.|
 Frog   188 DGFISYIYGSKFQMRSSERSAKKFK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 37/89 (42%)
pop4NP_001017252.1 UPF0086 127..209 CDD:376634 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31392
Inparanoid 1 1.050 111 1.000 Inparanoid score I4735
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362700at2759
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto103461
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1167
SonicParanoid 1 1.000 - - X4755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.