DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and Pop4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001009642.1 Gene:Pop4 / 292831 RGDID:1305955 Length:221 Species:Rattus norvegicus


Alignment Length:201 Identity:67/201 - (33%)
Similarity:107/201 - (53%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EHATSELREFISDLVIPH---QRCNVNINPDHITMLEGTKIKKQHSRKRRAHKSSTLSRREYAAL 63
            :.|.:.:|.|:.. .|||   |.|..::....:.:...|::|.:...|:::...|...|||   |
  Rat    25 QRAEAFVRAFLKQ-SIPHMSQQDCESHLQRKAVILEYFTRLKPKPRPKKKSKGLSAKQRRE---L 85

  Fly    64 GLNTLPTKQMKYEEALPLHHLWKGYVREHLELREGDEVPQVHDARYDEFSRKLVKLDLHGAKMKV 128
            .|..:..:|.:|...||||.|||.|:|:.....:.|..||:..|       ||:|.|||||.:.|
  Rat    86 RLFDIKPEQQRYSLFLPLHELWKQYIRDLCNGLKPDTQPQMIQA-------KLLKADLHGAVISV 143

  Fly   129 LQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECVFGMKVGNMEFTIFGQHLNIRPAER 193
            .:|||.:...:.||.:.:||:|.|::.|:..|:.|||..|||.:::.:....|:|....:|.:||
  Rat   144 TKSKCPSYVGVTGILLQETKHVFKIITKEDHLKVIPKQNCVFTIEIDDFISYIYGSKFQLRASER 208

  Fly   194 SVKKIK 199
            |.||.|
  Rat   209 SAKKFK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 35/89 (39%)
Pop4NP_001009642.1 UPF0086 129..211 CDD:280109 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354251
Domainoid 1 1.000 71 1.000 Domainoid score I9266
eggNOG 1 0.900 - - E1_KOG4046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31392
Inparanoid 1 1.050 109 1.000 Inparanoid score I4806
OMA 1 1.010 - - QHG58710
OrthoDB 1 1.010 - - D1362700at2759
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto96751
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.