DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and SPBC1703.01c

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001343005.1 Gene:SPBC1703.01c / 2539947 PomBaseID:SPBC1703.01c Length:217 Species:Schizosaccharomyces pombe


Alignment Length:208 Identity:63/208 - (30%)
Similarity:103/208 - (49%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSELREFISDLVIPHQRCNVNINP----DHITMLEGTKIKKQHSRKR--RAHKSSTLSRREYAAL 63
            |.|...|.:.::.|.:..|| ||.    ..:.::....::||..||.  .:.|...||.:|...|
pombe    19 TPESLVFQTKILTPEEAKNV-INEKIAFKPLLLVPSLNLEKQGDRKESVASKKRKKLSSKEKKKL 82

  Fly    64 GLNTLPTKQMKYEEALPLHHLWKGYVREHLELREGDEVPQVHDARYDEFSRKLVKLDLHGAKMKV 128
            .||.:| |...|.:...||.:|..|:.|.:....|:.:           ..||.|.:..||.|:|
pombe    83 QLNVVP-KIADYSQFKHLHSMWCSYILEVIAGCTGESL-----------MAKLAKAEYQGAYMQV 135

  Fly   129 LQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECVFGMKV------GNMEFTIFGQHLN 187
            |:||.:|...|.|||:.::|::|.|:.|::|:..:||.:.|  |||      ..:.|.::.|||.
pombe   136 LRSKSTTRVGLEGICIHESKHMLSLITKENRVVRVPKQDSV--MKVIVDVPQRKLVFELYTQHLL 198

  Fly   188 IRPAERSVKKIKN 200
            :|..:||.|:.|:
pombe   199 LRAGDRSNKRFKS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 35/96 (36%)
SPBC1703.01cNP_001343005.1 POP4 118..212 CDD:197780 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3048
eggNOG 1 0.900 - - E1_KOG4046
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1840
OMA 1 1.010 - - QHG58710
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto101094
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1167
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.