DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop4 and POP4

DIOPT Version :9

Sequence 1:NP_648168.1 Gene:Pop4 / 38889 FlyBaseID:FBgn0035831 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_006618.1 Gene:POP4 / 10775 HGNCID:30081 Length:220 Species:Homo sapiens


Alignment Length:158 Identity:59/158 - (37%)
Similarity:88/158 - (55%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QHSRKRRAHKSSTLSRREYAALGLNTLPTKQMKYEEALPLHHLWKGYVREHLELREGDEVPQVHD 106
            :|.||.:..|:..||.|:...|.|..:..:|.:|...||||.|||.|:|:.....:.|..||:..
Human    63 RHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQ 127

  Fly   107 ARYDEFSRKLVKLDLHGAKMKVLQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECVFG 171
            |       ||:|.|||||.:.|.:|||.:...:.||.:.:||::.|::.|:.||:.|||..|||.
Human   128 A-------KLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFT 185

  Fly   172 MKVGNMEFTIFGQHLNIRPAERSVKKIK 199
            ::.......|:|....:|.:|||.||.|
Human   186 VETDGFISYIYGSKFQLRSSERSAKKFK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop4NP_648168.1 POP4 111..201 CDD:197780 35/89 (39%)
POP4NP_006618.1 UPF0086 128..210 CDD:396440 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160181
Domainoid 1 1.000 70 1.000 Domainoid score I9570
eggNOG 1 0.900 - - E1_KOG4046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31392
Inparanoid 1 1.050 111 1.000 Inparanoid score I4879
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58710
OrthoDB 1 1.010 - - D1362700at2759
OrthoFinder 1 1.000 - - FOG0004374
OrthoInspector 1 1.000 - - oto89640
orthoMCL 1 0.900 - - OOG6_101654
Panther 1 1.100 - - LDO PTHR13348
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.