DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8209 and AT5G48690

DIOPT Version :9

Sequence 1:NP_648167.1 Gene:CG8209 / 38888 FlyBaseID:FBgn0035830 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_199680.2 Gene:AT5G48690 / 834927 AraportID:AT5G48690 Length:323 Species:Arabidopsis thaliana


Alignment Length:314 Identity:78/314 - (24%)
Similarity:126/314 - (40%) Gaps:90/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQTLMDMGFPRERVEYALEVTSNKGVEPAMEWLLAHVDDPIPSRQGAGESPGSTAQPAAAVDSSA 68
            ::.|.||||...|..:||..:.|..:|.|:.|::.|.::             |..:....|:.:.
plant    17 LKELEDMGFSMARAAWALHHSGNSSLEAAVNWIIDHENE-------------SQFENMPLVEFNI 68

  Fly    69 AAASSSTSGAGETSAPVAKSLKCDECGKVLRDHTEVEYHAAKTGHTKFSESEEEKKALTEEEKKA 133
            ...|.:.|                       |.|      |:|.|.:..|..|:.:.|.||::  
plant    69 EIESPNPS-----------------------DDT------AETSHARAKELSEQARKLREEQE-- 102

  Fly   134 QLALIEEKLKQKRIEREEREKIEALQREKNRIKSGKDMTEAKRRMEELEMKKIVEQRKREKDEEK 198
                          .:.|||      |||.||::||::.|.||..||.|.|:.:..||.||||||
plant   103 --------------TKRERE------REKERIRAGKELMETKRIAEENERKRNIALRKAEKDEEK 147

  Fly   199 AARDRVKAQIEADKAARKAREQKELGNAEPAPSVSSTTVSSPPAGVKSPPRDYTETRIQVRLQDG 263
            .||:::..::.|||..||.|    ||    .|:.:.:..:|.|.....|.|        :.:...
plant   148 KAREKIMLKVNADKLERKRR----LG----LPTETESASTSNPVSPLDPKR--------IVMSSP 196

  Fly   264 STLQETFNVKEQLSAVRVFIQMKTGIESP------FSLMTTFPRKLFAEDDYEK 311
            |.:.:...::|.|.::|    .....|.|      |..:.|..|.:..:.|.|:
plant   197 SVVSKAEEMRECLRSLR----RNHKDEDPRITRRVFETLLTIVRNVAKKPDEER 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8209NP_648167.1 UBA_UBXN1 2..42 CDD:270487 13/37 (35%)
SAKS1_UBX 250..328 CDD:176367 11/68 (16%)
AT5G48690NP_199680.2 UBA_PUB_plant 11..59 CDD:270476 14/54 (26%)
PUB_UBA_plant 209..316 CDD:198419 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1297214at2759
OrthoFinder 1 1.000 - - FOG0003698
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.