DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8209 and AT2G43210

DIOPT Version :9

Sequence 1:NP_648167.1 Gene:CG8209 / 38888 FlyBaseID:FBgn0035830 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001324539.1 Gene:AT2G43210 / 818922 AraportID:AT2G43210 Length:531 Species:Arabidopsis thaliana


Alignment Length:361 Identity:77/361 - (21%)
Similarity:130/361 - (36%) Gaps:103/361 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEVQTLMDMGFPRERVEYALEVTSNKGVEPAME--WLLAHVDDPIPSRQGA------GESPGSTA 58
            |.|..:..:||...:|.......:.:.:..::|  ||..|:.:...|...|      .|:|.|:|
plant    81 SSVPCIAAIGFSGTQVWRTEGFITAEDLASSLEKAWLGLHIQETTASIFSAALASQNSETPVSSA 145

  Fly    59 Q----PAAAVDSSAAAASSSTSGA---GETSAPVAK-----------SLKCDECGKV--LRDHTE 103
            .    |..:|...||.||.||:.:   .||.:.|..           ::|..|..:.  |.|.|:
plant   146 SSVVLPPGSVPLDAAVASPSTASSVQPSETKSTVTSASTTENNDGTVAVKGKESAEPSNLCDTTK 210

  Fly   104 -------------VEYHAAKTGHTKFSESEEEKKAL--TEEEKKAQLALIEEKLKQKRIEREERE 153
                         ||:.|.:|.....:|.|..:...  |.:......:.::.|.||..:..||..
plant   211 NQPAPSVDGTKANVEHEATETPLRVQAEKEPIRPTAPGTNDNTSRVRSSVDRKRKQGTVINEEDS 275

  Fly   154 KIEALQREKNRIKSGKDMTEAKRRMEELEMKKIVEQRKREKDEEKAARDRVKAQIEADKAARKAR 218
            .:....|:.|..||          ::..|..|..::...|:|.||               ::|| 
plant   276 GVGVSGRDINLTKS----------VDTKETMKPKDEGGEEEDGEK---------------SKKA- 314

  Fly   219 EQKELGNAEPAPSVSSTTVSSPPAGVKSPPRDYTETRIQVRLQDGSTLQETFNVKEQLSAVRVFI 283
                                             ::..:.:||.|||:|||.|:|...|..|:.::
plant   315 ---------------------------------SDVHLNIRLPDGSSLQEKFSVTSILRMVKDYV 346

  Fly   284 QMKTGIE-SPFSLMTTFPRKLFAEDDYEKPLEVLGL 318
            .....|. ..:.|...:|||::.:.|.:|.|..|.|
plant   347 NSNQTIGLGAYDLAVPYPRKVYTDQDLDKSLSELRL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8209NP_648167.1 UBA_UBXN1 2..42 CDD:270487 9/41 (22%)
SAKS1_UBX 250..328 CDD:176367 22/70 (31%)
AT2G43210NP_001324539.1 UAS 8..116 CDD:239256 6/34 (18%)
UBX 313..392 CDD:395637 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.