DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8209 and SPAC17C9.11c

DIOPT Version :9

Sequence 1:NP_648167.1 Gene:CG8209 / 38888 FlyBaseID:FBgn0035830 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_594595.1 Gene:SPAC17C9.11c / 2542167 PomBaseID:SPAC17C9.11c Length:240 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:80/249 - (32%)
Similarity:122/249 - (48%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LKCDECGKVLRDHTEVEYHAAKTGHTKFSESEEEKKALTEEEKKAQLALIEEKLKQKRIEREERE 153
            |||.||.|:|......|:|:.||.|.:|.|:|||.|..:.||.|..:..:.||.|:|:    |:|
pombe     3 LKCLECDKLLSSIEMAEFHSTKTSHDQFEETEEEIKKRSPEELKQAIEALREKAKEKK----EKE 63

  Fly   154 KIEALQREKNRI----KSGKDMTEAKRRMEELEMKKIVEQRKREKDEEKAARDRVKAQIEADKAA 214
            :|.||:.:|...    ||..:..:|.|:|::....:.:::.:::|.|:...|.::.|:||.||..
pombe    64 RILALEEKKTNYKILQKSNDETAQAMRKMQDQARLRDLQKIRQQKAEDAEQRKKILAEIERDKKR 128

  Fly   215 RKA-REQKELGNAEPAPSV--------SSTTVSSPPAGVKSPPRDYTETRIQVRLQDGSTLQETF 270
            |.| ||.|.....|.|..:        |||...:||          |..|..:| .||.....|.
pombe   129 RAAERENKNSSVKETAAPIKQPKNANSSSTCTRTPP----------TSGRFSIR-HDGQVCNITI 182

  Fly   271 NVKEQLSAVRVFIQMKTGIESPFSLMTTFPRKLFAEDDYEKPLEVLGLVPSAVI 324
            ..:|.|..:...:..|..:..|....|||||..:..|.::||:..|.|.||||:
pombe   183 AAEETLRQLAQQVAEKMNVSPPTKFTTTFPRASYGTDVFDKPVNQLDLFPSAVL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8209NP_648167.1 UBA_UBXN1 2..42 CDD:270487
SAKS1_UBX 250..328 CDD:176367 24/75 (32%)
SPAC17C9.11cNP_594595.1 UBQ 174..239 CDD:294102 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2152
eggNOG 1 0.900 - - E1_KOG2689
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9283
Inparanoid 1 1.050 119 1.000 Inparanoid score I1506
OMA 1 1.010 - - QHG52921
OrthoFinder 1 1.000 - - FOG0003698
OrthoInspector 1 1.000 - - oto100760
orthoMCL 1 0.900 - - OOG6_104595
Panther 1 1.100 - - LDO PTHR46340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.