DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8209 and ubxn-4

DIOPT Version :9

Sequence 1:NP_648167.1 Gene:CG8209 / 38888 FlyBaseID:FBgn0035830 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001370812.1 Gene:ubxn-4 / 176187 WormBaseID:WBGene00022703 Length:469 Species:Caenorhabditis elegans


Alignment Length:277 Identity:78/277 - (28%)
Similarity:125/277 - (45%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 STAQPAAAVDSSAAAASSSTSGAGETSAPVAKSLKCDECGKVLRDHTEVEYHAAKTGHTKFSESE 120
            ||..|:.|.....|:..:........:||:..|                            |.|:
 Worm   127 STPSPSPAPVQVPASTDAPIPAPTPVTAPIQSS----------------------------STSQ 163

  Fly   121 EEKKALTEEEKKAQLALIEEKLKQKRIEREEREKIEALQREKNRIKSGKDMTEAKRRMEELEMKK 185
            |..:.|.|:..:|: ||:|:| |||..|: :||..:.::.|..:.:      |||:..:...:.|
 Worm   164 EMTRELAEKVARAK-ALLEQK-KQKDAEK-KREADKHVKEEMTKAR------EAKQERDAEALVK 219

  Fly   186 IVEQRKREKDEEKAARDRVKAQIEADKAARKAREQKELGNAEPAPSVSSTTVSSPPAGV-KSPPR 249
            ..:|||.||...::.:.|:.|||:||:.|    .||:.|......:.|..|.......| |:.|.
 Worm   220 AAKQRKMEKLAAESDKKRILAQIKADREA----AQKKFGKLVNTENASENTEKKQETTVGKAVPS 280

  Fly   250 DYTETRIQVRLQDGSTLQETFNVKEQLSAVRVFIQMKTGIE-SPFSLMTTFPRKLFAEDDYEKPL 313
            |  ..|:||||.||||..|.|...:.|:::...|:.|..|. :.|.:...:||::|..|||.|..
 Worm   281 D--RCRLQVRLPDGSTFVEEFPSNDVLNSLVEIIRQKPSIAGTTFEIQQPYPRRIFTNDDYSKTF 343

  Fly   314 EVLGLVPS-AVITMTKT 329
            ....|.|| |::.:.|:
 Worm   344 LENQLTPSTALVVIQKS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8209NP_648167.1 UBA_UBXN1 2..42 CDD:270487
SAKS1_UBX 250..328 CDD:176367 28/79 (35%)
ubxn-4NP_001370812.1 PRK05641 85..>159 CDD:235540 7/31 (23%)
tolA_full <167..>252 CDD:274303 31/97 (32%)
UBX_UBXN4 282..358 CDD:340534 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.