DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and UBXN1

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_056937.2 Gene:UBXN1 / 51035 HGNCID:18402 Length:312 Species:Homo sapiens


Alignment Length:307 Identity:87/307 - (28%)
Similarity:138/307 - (44%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PTGGVEEAKTNPPNSPVAASLASIPAAVSTSSLEGKSGSEAEAASPTALA-AEKRAAASKVEGSA 238
            |.|..|:|.....|..:.|::..:        :|.:...:.:....|.|. ...|...|..:|..
Human    16 PRGRAEKALALTGNQGIEAAMDWL--------MEHEDDPDVDEPLETPLGHILGREPTSSEQGGL 72

  Fly   239 TTSGAAARNFATNNLIPAVPLMTPAVPVPTQRPLEAQDNTESEERLAEVRNILE---QKRKERVE 300
            ..||:||.                          |.:.....|||..:.:.:||   ||::||.|
Human    73 EGSGSAAG--------------------------EGKPALSEEERQEQTKRMLELVAQKQREREE 111

  Fly   301 EEKRMEKENELRRRRDGREAQSQQARAKEQELKNMQEQIKRERQEELAARERIRAQIAADRAEQA 365
            .|:|...|.|.:|||.|:|..:.:.|.:|.|::...|:.:||:.||||||:|:|.:|..|:||:|
Human   112 REEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERA 176

  Fly   366 QRF------NTPDISSTTNSVAATAASNVITTDASVSSVDETRLQIRLPGGIQRTKSFPAGEVLA 424
            :::      ..|.::.....|.::.:....|.    ...|:.|:|:|||.|...|::|.|.|.||
Human   177 KKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK----REYDQCRIQVRLPDGTSLTQTFRAREQLA 237

  Fly   425 TVRVYV---RNEMLAASDVRDFTLATSYPRREFQTEDEVKTLNELNL 468
            .||:||   |.|.|.... ....|.:.:|||.|...|..:.|.||.:
Human   238 AVRLYVELHRGEELGGGQ-DPVQLLSGFPRRAFSEADMERPLQELGM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 39/165 (24%)
GBP_C <272..367 CDD:303769 39/97 (40%)
coiled coil 342..353 CDD:293879 7/10 (70%)
UBQ 399..476 CDD:294102 29/73 (40%)
UBXN1NP_056937.2 UBA_UBXN1 5..45 CDD:270487 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..211 52/199 (26%)
UBQ 210..283 CDD:294102 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S3959
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.