DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and ubxn1

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001004957.1 Gene:ubxn1 / 448372 XenbaseID:XB-GENE-979857 Length:287 Species:Xenopus tropicalis


Alignment Length:294 Identity:98/294 - (33%)
Similarity:148/294 - (50%) Gaps:47/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 AEKRAAASKVEGSATTSGAAARNFATNN--LIPAVPLMT----------PAVPVP---------T 268
            ||.....|.:|...:.|.|.....||.|  :.||:..:.          |:|.||         |
 Frog     2 AECSTLESLIEMGFSPSRAEKALAATGNQGIEPAMDWLVEHEDDPDIDEPSVVVPEDSDSGTTDT 66

  Fly   269 Q--------RPLEAQDNTESEERLAEVRNILEQKRKERVEEEKRMEKENELRRRRDGREAQSQQA 325
            |        .||..::..:..:|:.|   ::.||:|||.|.|||...|.|.:||:.|:|..:.:.
 Frog    67 QGMDTCEERLPLTEEEKEKQTKRMME---LIAQKQKEREEREKRERIEQEKQRRKQGQELSAVKQ 128

  Fly   326 RAKEQELKNMQEQIKRERQEELAARERIRAQIAADRAEQAQRFNTPDISSTTNSVAATAASNVIT 390
            :.:|||::...|..:||:|||..||:|:|.:||.|:||:|:||.    .:.:..::..|.:::..
 Frog   129 KIQEQEMQKAVEDRRREKQEEKLARDRVREKIARDKAERARRFG----GAGSEPISPPAEASIPA 189

  Fly   391 TDASVSS----------VDETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLAASDVRDFTL 445
            |..|.||          .|:.|:|:||..|...:::|.|.|.||.||:||.......:. ..|.|
 Frog   190 TTPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGAP-GPFNL 253

  Fly   446 ATSYPRREFQTEDEVKTLNELNLVPNAVVLVLTK 479
            .||:|||.|..||..|.|.||.|||:||::|..|
 Frog   254 LTSFPRRVFTEEDMEKPLQELGLVPSAVLIVARK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 39/140 (28%)
GBP_C <272..367 CDD:303769 37/94 (39%)
coiled coil 342..353 CDD:293879 6/10 (60%)
UBQ 399..476 CDD:294102 34/76 (45%)
ubxn1NP_001004957.1 UBA_UBXN1 5..45 CDD:270487 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..207 51/169 (30%)
UBX_UBXN1 204..285 CDD:340470 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.