DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and ubxn1

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:XP_017214474.1 Gene:ubxn1 / 322073 ZFINID:ZDB-GENE-030131-792 Length:296 Species:Danio rerio


Alignment Length:239 Identity:77/239 - (32%)
Similarity:126/239 - (52%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PTQRPLEAQDNTE--------SEERLAEVR---NILEQKRKERVEEEKRMEKENELRRRRDGREA 320
            ||:.|...:|..|        .|||..:|:   ::::.:::||.|.|::...|.|.:||:.|:|.
Zfish    72 PTEIPESIEDTEEGNARQPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQEL 136

  Fly   321 QSQQARAKEQELKNMQEQIKRERQEELAARERIRAQIAADRAEQAQRF--------------NTP 371
            ...:.:.::.|:|.:.:|.::|:.|:..|::|::.:||.||.|:||:|              ..|
Zfish   137 LQVRQKLQDDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAP 201

  Fly   372 DISSTTNSVAATAASNVITTDASVSSVDETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLA 436
            .:|...|..|..|..:          .|:.|:|:||..|...:..|.|.|.||.|||||:   :.
Zfish   202 ALSPPENQGAPPAKKD----------YDDCRIQVRLLDGTTLSTVFKAQEPLAAVRVYVQ---MN 253

  Fly   437 ASDVRDFTLATSYPRREFQTEDEVKTLNELNLVPNAVVLVLTKE 480
            .::.:||.|.|.||||.:...|..|.|.||.|||:| |||:||:
Zfish   254 GANGQDFNLITPYPRRVYTDLDMEKPLRELGLVPSA-VLVVTKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 21/80 (26%)
GBP_C <272..367 CDD:303769 29/105 (28%)
coiled coil 342..353 CDD:293879 3/10 (30%)
UBQ 399..476 CDD:294102 34/76 (45%)
ubxn1XP_017214474.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.