DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and Ubxn1

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001030001.1 Gene:Ubxn1 / 293719 RGDID:1309471 Length:297 Species:Rattus norvegicus


Alignment Length:329 Identity:96/329 - (29%)
Similarity:147/329 - (44%) Gaps:74/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PTGGVEEAKTNPPNSPVAASL-----------ASIPAAVSTSSLEGKSGSEAEAASPTALAAEKR 228
            |.|..|:|.....|..:.|::           ...|.....|.:.|:..:.:|...|        
  Rat    16 PRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLSHILGREPTPSEQVGP-------- 72

  Fly   229 AAASKVEGSATTSGAAARNFATNNLIPAVPLMTPAVPVPTQRPLEAQDNTESEERLAEVRNILE- 292
                  |||.:.:|.:.            |::|                  .|||..:.:.:|| 
  Rat    73 ------EGSGSAAGESK------------PVLT------------------EEERQEQTKRMLEL 101

  Fly   293 --QKRKERVEEEKRMEKENELRRRRDGREAQSQQARAKEQELKNMQEQIKRERQEELAARERIRA 355
              ||::||.|.|:|...|.|.:|||..:|..:.:.|.:|.|::...|:.:||:.||||||:|:|.
  Rat   102 VAQKQREREEREEREALEREKQRRRQRQELSAARQRLQEDEIRRAAEERRREKAEELAARQRVRE 166

  Fly   356 QIAADRAEQAQRFNTPDISSTTNSVAATAASNVITTDAS-------VSSVDETRLQIRLPGGIQR 413
            :|..|:||:||::     ..|..|.::..|::.....:|       ....|:.|:|:|||.|...
  Rat   167 KIERDKAERAQKY-----GGTVGSRSSPPATDPGPVPSSPRQEPPTKREYDQCRIQVRLPDGTSL 226

  Fly   414 TKSFPAGEVLATVRVYV---RNEMLAASDVRDFTLATSYPRREFQTEDEVKTLNELNLVPNAVVL 475
            |.||.|.|.||.||:||   |.|. ...|.....|.:.:|||.|...|..:.|.||.|||:||::
  Rat   227 TLSFRAREQLAAVRLYVELHRGEE-PGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLV 290

  Fly   476 VLTK 479
            |..|
  Rat   291 VAKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 38/175 (22%)
GBP_C <272..367 CDD:303769 37/97 (38%)
coiled coil 342..353 CDD:293879 7/10 (70%)
UBQ 399..476 CDD:294102 35/79 (44%)
Ubxn1NP_001030001.1 UBA_UBXN1 5..45 CDD:270487 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..212 53/222 (24%)
Interaction with BRCA1. /evidence=ECO:0000250 43..297 90/302 (30%)
SAKS1_UBX 210..293 CDD:176367 36/83 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.