DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and SPAC17C9.11c

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_594595.1 Gene:SPAC17C9.11c / 2542167 PomBaseID:SPAC17C9.11c Length:240 Species:Schizosaccharomyces pombe


Alignment Length:215 Identity:55/215 - (25%)
Similarity:104/215 - (48%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 EAQDNTESEERLAEVRNILEQKRKERVEEEKRMEKEN-----ELRRRRDGREAQSQQARAKEQEL 332
            |.:....|.|.|.:....|.:|.||:.|:|:.:..|.     ::.::.:...||:.:....:..|
pombe    34 EEEIKKRSPEELKQAIEALREKAKEKKEKERILALEEKKTNYKILQKSNDETAQAMRKMQDQARL 98

  Fly   333 KNMQEQIKRERQEELAARERIRAQIAADRAEQ-AQRFNTPDISSTTNSVAATAASNVITTDASVS 396
            :::| :|::::.|:...|::|.|:|..|:..: |:|.|      ..:||..|||......:|:.|
pombe    99 RDLQ-KIRQQKAEDAEQRKKILAEIERDKKRRAAEREN------KNSSVKETAAPIKQPKNANSS 156

  Fly   397 SV------DETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLAASDVRDFTLATSYPRREFQ 455
            |.      ...|..||..|.:... :..|.|.|..:...|..:|..:...: ||  |::||..:.
pombe   157 STCTRTPPTSGRFSIRHDGQVCNI-TIAAEETLRQLAQQVAEKMNVSPPTK-FT--TTFPRASYG 217

  Fly   456 TEDEVKTLNELNLVPNAVVL 475
            |:...|.:|:|:|.|:||::
pombe   218 TDVFDKPVNQLDLFPSAVLI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 14/68 (21%)
GBP_C <272..367 CDD:303769 23/99 (23%)
coiled coil 342..353 CDD:293879 2/10 (20%)
UBQ 399..476 CDD:294102 22/77 (29%)
SPAC17C9.11cNP_594595.1 UBQ 174..239 CDD:294102 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.