DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8042 and ubxn-1

DIOPT Version :9

Sequence 1:NP_648165.1 Gene:CG8042 / 38886 FlyBaseID:FBgn0027554 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_490978.1 Gene:ubxn-1 / 171804 WormBaseID:WBGene00017733 Length:299 Species:Caenorhabditis elegans


Alignment Length:214 Identity:75/214 - (35%)
Similarity:112/214 - (52%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 RPLEAQDNTESEERLAEVRNILE-----QKRKERVEEEKRMEKENELRRRRDGREAQSQQARAKE 329
            :||.|      ||:.|:|..|.|     |.:|.::|.|:..|||.  :||.||:...|.:..|::
 Worm   102 KPLTA------EEKAAKVLEIREKIKVHQAKKAKLEAEENREKEK--KRREDGKAMISHKEAARD 158

  Fly   330 QELKNMQEQIKRERQEELAARERIRAQIAADR-AEQAQRFNTPDISSTTNSVAATAASNVITTDA 393
            :|::...:..:||:.|:..||:|:..||..|: |.:|:....|    ...:..|.:|:.|    |
 Worm   159 REIREAAQDRRREKNEDEIARKRVLEQIRLDKEARKAKASGQP----VPEAKPAPSAAPV----A 215

  Fly   394 SVSSVDETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLAASDVRDFTLATSYPRREFQTED 458
            .......|.||.||..|....:.|.|.|.||.||.:|  |...|:.| .|||.|.:||:.| |||
 Worm   216 PPKDYSTTTLQFRLLDGQTVRQQFEANEPLAMVRAWV--ETNHANGV-PFTLMTPFPRKVF-TED 276

  Fly   459 EVKT-LNELNLVPNAVVLV 476
            ::.| |..|||||:|.|::
 Worm   277 DMGTPLKVLNLVPSANVIL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8042NP_648165.1 DUF3682 170..337 CDD:289231 23/71 (32%)
GBP_C <272..367 CDD:303769 33/100 (33%)
coiled coil 342..353 CDD:293879 4/10 (40%)
UBQ 399..476 CDD:294102 36/77 (47%)
ubxn-1NP_490978.1 UBA_like_SF 1..36 CDD:328731
Neuromodulin_N <86..>197 CDD:331332 34/102 (33%)
SAKS1_UBX 219..297 CDD:176367 36/81 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S3959
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.