DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNaseX25 and RNS3

DIOPT Version :9

Sequence 1:NP_523966.2 Gene:RNaseX25 / 38885 FlyBaseID:FBgn0010406 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_564264.1 Gene:RNS3 / 839225 AraportID:AT1G26820 Length:222 Species:Arabidopsis thaliana


Alignment Length:215 Identity:66/215 - (30%)
Similarity:95/215 - (44%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 REMSVQD--HNWDVLIFTQQWPVTTCYHWREENPDQECSLPQKKE---FWTIHGIWPTKLHQMGP 126
            :::.||.  .::|...|..|||...|      :....|..||..:   .:.|||:||.......|
plant    11 QQLYVQSFAQDFDFFYFVLQWPGAYC------DSRHSCCYPQTGKPAADFGIHGLWPNYKTGGWP 69

  Fly   127 NFCNNSANFDPSKLNPIEDRLETFWPDLK-----GMDSTEWLWKHEWQKHGTCAMLVEELDNELK 186
            ..||..:.||..:::.:...|:..||.|.     ||.    .|.|||:||||||  ..|||.. .
plant    70 QNCNPDSRFDDLRVSDLMSDLQREWPTLSCPSNDGMK----FWTHEWEKHGTCA--ESELDQH-D 127

  Fly   187 YFEQGLTWREEYIMSRILDASDIHPDSN-NTVAAINNAIVKALGKNPSIHCLYDGKHGISYLSEI 250
            |||.||..:::..:...|..:.|.||.. ..:..|.|.|.:.:|..|.|.|..|..|. |.|.:|
plant   128 YFEAGLKLKQKANLLHALTNAGIKPDDKFYEMKDIENTIKQVVGFAPGIECNKDSSHN-SQLYQI 191

  Fly   251 RICFSKSL-ELIDCDGIKQG 269
            .:|...|. :.|:|..:..|
plant   192 YLCVDTSASKFINCPVMPHG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNaseX25NP_523966.2 Ribonuclease_T2 80..256 CDD:278852 59/184 (32%)
RNS3NP_564264.1 RNase_T2_euk 22..213 CDD:238512 64/204 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_KOG1642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31190
Inparanoid 1 1.050 94 1.000 Inparanoid score I2235
OMA 1 1.010 - - QHG54860
OrthoDB 1 1.010 - - D994722at2759
OrthoFinder 1 1.000 - - FOG0002105
OrthoInspector 1 1.000 - - otm2533
orthoMCL 1 0.900 - - OOG6_101324
Panther 1 1.100 - - O PTHR11240
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1394
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.