DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNaseX25 and rnaset2

DIOPT Version :9

Sequence 1:NP_523966.2 Gene:RNaseX25 / 38885 FlyBaseID:FBgn0010406 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001072716.1 Gene:rnaset2 / 780173 XenbaseID:XB-GENE-944135 Length:250 Species:Xenopus tropicalis


Alignment Length:195 Identity:76/195 - (38%)
Similarity:108/195 - (55%) Gaps:19/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HN--WDVLIFTQQWPVTTCYHWREENPDQECSLPQKKEFWTIHGIWPTKLHQMGPNFCNNSANFD 136
            ||  |..||.|..||.|.|     |.....|..|.|  :||:||:||.|. ||    ||||..|:
 Frog    30 HNQEWKKLILTHHWPATVC-----EMDHSHCKNPPK--YWTLHGLWPDKA-QM----CNNSWPFE 82

  Fly   137 PSKLNPIEDRLETFWPDLKGMDSTEWLWKHEWQKHGTCAMLVEELDNELKYFEQGLTWREEYIMS 201
            .|::..|...|..:|||:...:.:: |||||||||||||..:|.|:.:.|||.:||....:..::
 Frog    83 YSEIQDILPELNHYWPDILHPNKSQ-LWKHEWQKHGTCAASLECLNTQHKYFSKGLELYTKVDLN 146

  Fly   202 RILDASDIHPDSN-NTVAAINNAIVKALGKNPSIHCL--YDGKHGISYLSEIRICFSKSLELIDC 263
            .:|:.|.|.|.:. ..:..|.|||:...|..|.|.|:  :.|:: :..|.:|.|||:|.|:|.:|
 Frog   147 SVLEKSGIVPSTKYYQIKDIENAIIGCFGVVPKIQCVPPHQGEN-VQTLGQIEICFTKELQLRNC 210

  Fly   264  263
             Frog   211  210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNaseX25NP_523966.2 Ribonuclease_T2 80..256 CDD:278852 68/178 (38%)
rnaset2NP_001072716.1 Ribonuclease_T2 38..204 CDD:306862 68/179 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5936
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31190
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D580789at33208
OrthoFinder 1 1.000 - - FOG0002105
OrthoInspector 1 1.000 - - oto105397
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2263
SonicParanoid 1 1.000 - - X1394
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.