DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNaseX25 and Rnaset2b

DIOPT Version :9

Sequence 1:NP_523966.2 Gene:RNaseX25 / 38885 FlyBaseID:FBgn0010406 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_080887.1 Gene:Rnaset2b / 68195 MGIID:3702087 Length:259 Species:Mus musculus


Alignment Length:246 Identity:75/246 - (30%)
Similarity:115/246 - (46%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HNWDVLIFTQQWPVTTCYHWREENPDQECSLPQKKEFWTIHGIWPTKLHQMGPNFCNNSANFDPS 138
            |.|..||.||.||.|.|   :|.|..|: ||    ::|||||:||.:...     ||.|.:|:..
Mouse    37 HEWKKLILTQHWPPTVC---KEVNSCQD-SL----DYWTIHGLWPDRAED-----CNQSWHFNLD 88

  Fly   139 KLNPIEDRLETFWPDLKGMDST-EWLWKHEWQKHGTCAMLVEELDNELKYFEQGLTWREEYIMSR 202
            ::..:...::.:|||:....|. ...|||||.||||||..|:.|::|.|||.:.|...::..::.
Mouse    89 EIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNS 153

  Fly   203 ILDASDIHPDSN-NTVAAINNAIVKALGKNPSIHCLY-DGKHGISYLSEIRICFSK-SLELIDCD 264
            :|....|.|..| ..:|...:|:.:..|..|.|.||. :....:..:.:|.:||:| .|.|.:| 
Mouse   154 VLQKFGIKPSINYYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNC- 217

  Fly   265 GIKQGD----------AVPVGVPGGTIITNCHIGSLVHYPSLVPPLQRKSH 305
             .:.|:          |:.....|..:   |..|     |...||..:..|
Mouse   218 -TEPGEQLSSRQEAWLAMEASTHGMMV---CEDG-----PIFYPPPTKTQH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNaseX25NP_523966.2 Ribonuclease_T2 80..256 CDD:278852 59/178 (33%)
Rnaset2bNP_080887.1 RNase_T2_euk 39..221 CDD:238512 65/196 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846152
Domainoid 1 1.000 109 1.000 Domainoid score I6359
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31190
Inparanoid 1 1.050 113 1.000 Inparanoid score I4838
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54860
OrthoDB 1 1.010 - - D580789at33208
OrthoFinder 1 1.000 - - FOG0002105
OrthoInspector 1 1.000 - - otm44255
orthoMCL 1 0.900 - - OOG6_101324
Panther 1 1.100 - - LDO PTHR11240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1394
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.