DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNaseX25 and rnst-2

DIOPT Version :9

Sequence 1:NP_523966.2 Gene:RNaseX25 / 38885 FlyBaseID:FBgn0010406 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_503370.1 Gene:rnst-2 / 190096 WormBaseID:WBGene00019624 Length:279 Species:Caenorhabditis elegans


Alignment Length:233 Identity:65/233 - (27%)
Similarity:100/233 - (42%) Gaps:55/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DGFPFREDDDSLQDSSREMSVQDHNWDVLIFTQQWPVTTCYHWREENPDQECSLPQKKEFWTIHG 115
            ||.||                     |.|:||..:|...| ...:::..:.|.:|.....|:|||
 Worm    19 DGEPF---------------------DYLMFTTIYPTAVC-RADDDSVPESCEIPSGTPQWSIHG 61

  Fly   116 IWPTKLHQMGPNFCNNS-ANFDPSKLNPIEDRLETFWPDLKGMDSTEWLWKHEWQKHGTCAMLVE 179
            :||...:...|..|..: .:||.:.:..|||||...||:|....:.:..||||:.||||||...:
 Worm    62 LWPNFENGSYPQNCRGTPRHFDENLIKSIEDRLVVVWPNLYPKKTIQSFWKHEYDKHGTCAQSEK 126

  Fly   180 ELDNELKYFEQGLTWREEYIMSRILDASDI---------------HPDSNNTVAAINNAIVKALG 229
            ..::||.||.:         :.::.|:.|:               ..|..|.::.:.:      |
 Worm   127 LFESELAYFTE---------VMKVFDSIDVAGGLKSVGPSEKPITSSDLKNALSGVTS------G 176

  Fly   230 KNPSIHCLYDGKHGISYLSEIRICFSKSLELIDC--DG 265
            |....|||.|.|.....|.:||:|.:|.|.:.||  ||
 Worm   177 KTFQFHCLRDKKTKQFLLGDIRLCLNKDLTIRDCPTDG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNaseX25NP_523966.2 Ribonuclease_T2 80..256 CDD:278852 53/191 (28%)
rnst-2NP_503370.1 RNase_T2_euk 23..217 CDD:238512 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164154
Domainoid 1 1.000 104 1.000 Domainoid score I4231
eggNOG 1 0.900 - - E1_KOG1642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31190
Inparanoid 1 1.050 104 1.000 Inparanoid score I3529
Isobase 1 0.950 - 0 Normalized mean entropy S4543
OMA 1 1.010 - - QHG54860
OrthoDB 1 1.010 - - D580789at33208
OrthoFinder 1 1.000 - - FOG0002105
OrthoInspector 1 1.000 - - oto18728
orthoMCL 1 0.900 - - OOG6_101324
Panther 1 1.100 - - LDO PTHR11240
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2263
SonicParanoid 1 1.000 - - X1394
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.