DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and YOX1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:56/230 - (24%)
Similarity:91/230 - (39%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 SPSPDGMSRSESPTSSHRSS------PPISPGCEDQQQPHGALHPQHLSM--RMSDFHDEFKKPI 355
            |.||...|.:...||.|...      ||::......:....||.....|:  ..|.:.|:..|..
Yeast    21 SSSPVSPSFTNPRTSFHLDDRGTIKLPPLNTSINRPRSVESALRHTVTSLHENSSAYGDDMLKHT 85

  Fly   356 PPHSPIRPQ--------D--------FPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNF 404
            ...|.:..|        |        .||.:....|.:.::..... .||. :.|.|.||.... 
Yeast    86 QSDSALSSQLNSSQETVDESHENLLLTPLNSKKRDYSVSSKKNDIL-TPLS-AAKSIIIPSASK- 147

  Fly   405 MPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKR 469
             ..:..|.|:..:   ....|:......:|.|.:.:|.||  :||:|..|:.:|::....|:.||
Yeast   148 -EKRRAFAFITHS---QETFPKKEPKIDNAPLARRKRRRT--SSQELSILQAEFEKCPAPSKEKR 206

  Fly   470 FEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEA 504
            .|:|....::|..|:|||||:|...||.:.|..::
Yeast   207 IELAESCHMTEKAVQIWFQNKRQAVKRQRIATSKS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 20/52 (38%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.