DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and AtHB23

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:141 Identity:35/141 - (24%)
Similarity:51/141 - (36%) Gaps:45/141 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 HHRIPELAAYPH-----HAILGKTRRP----------------------------RTAFTSQQLL 452
            ||:  |...:|.     |..||| |.|                            :.....:||.
plant    20 HHQ--EEEDHPQLLQDFHGFLGK-RSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLK 81

  Fly   453 ELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRS---------KKAQQEAKERA 508
            .|||.|:....|...::.|:|..|.|...|:.|||||||.:.|..         |:..:..::..
plant    82 ALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDEN 146

  Fly   509 KANQQQQQQQQ 519
            :..|.|.|:.|
plant   147 EVLQTQNQKLQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 20/80 (25%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 19/52 (37%)
HALZ 126..168 CDD:396657 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.