DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and lbx1

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:72 Identity:34/72 - (47%)
Similarity:43/72 - (59%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 KTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQ 502
            |.|:.|||||:.|:.||||:|...||||...|.::|..|.|:..||..||||||.|.||..:..:
 Frog   124 KRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMK 188

  Fly   503 EAKERAK 509
            ...|..|
 Frog   189 ADVESVK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 29/55 (53%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Homeodomain 126..182 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.