DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa6

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:273 Identity:70/273 - (25%)
Similarity:93/273 - (34%) Gaps:102/273 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 DQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSS 318
            |:...:..|...||:..|...|:...|.       ......::....||.|.|:...|......|
  Rat    49 DKTYTSPCFYQQSNSVLACNRASYEYGA-------SCFYSDKDLSGASPSGNSKQRGPGDYLHFS 106

  Fly   319 PPISPGCEDQQQPHG------ALHPQHLSMRMSDFHDEFKKPIPPHSPIRP--QDFPLYAGGHPY 375
            |      |.|.:|..      |||.:....:.:             ||:.|  |.....||    
  Rat   107 P------EQQYKPDSSSVQGKALHEEGTDRKYT-------------SPVYPWMQRMNSCAG---- 148

  Fly   376 QLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTR 440
                                                                |.|..|.     |
  Rat   149 ----------------------------------------------------AVYGSHG-----R 156

  Fly   441 RPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK------ 499
            |.|..:|..|.|||||:|..|:||:|.:|.|:|:.|.|:|.|:||||||||||||:..|      
  Rat   157 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQ 221

  Fly   500 AQQEAKERAKANQ 512
            |..|..| |||.:
  Rat   222 ASGEDSE-AKAGE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.