DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxa5a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:331 Identity:79/331 - (23%)
Similarity:114/331 - (34%) Gaps:134/331 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 NPPGVPSGAAAPPPVSPQPAANHLSHSG----ATMATTTLLPPAQSQPKKSFCIDALLAKSQHQS 234
            |...:.:|.::|         .|...||    :...:.|..|...:||..:            .|
Zfish    11 NGMDLSTGHSSP---------GHFLSSGERTQSYKDSPTATPVRYNQPVTA------------SS 54

  Fly   235 GEPQPIIVDDRLAALHYARDQ-AELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYD 298
            .||.    .|.|.....|... :|.:|..:..|.::.|..|:.| .|.:..:|.:.::..|.|.:
Zfish    55 AEPS----SDHLPCSSLANSPVSEQSHRALKISLSSTAGSASKS-FGTVLSREGVSKVSSSMEEE 114

  Fly   299 SPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRP 363
            .|...|.:.|::.:    .:|.|.|.          :...|:|      ||..            
Zfish   115 KPPGSGQTASQNVS----EAPQIYPW----------MRKLHIS------HDNL------------ 147

  Fly   364 QDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELA 428
                  ||                   |.||                                  
Zfish   148 ------AG-------------------PEGK---------------------------------- 153

  Fly   429 AYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMK 493
                        |||||:|..|.|||||:|..|:||:|.:|.|:|..|.|||.|:||||||||||
Zfish   154 ------------RPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMK 206

  Fly   494 WKRSKK 499
            ||:..|
Zfish   207 WKKDNK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.