DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxa3a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:245 Identity:75/245 - (30%)
Similarity:103/245 - (42%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 QAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPG-------CEDQQQ 330
            |:|.......|:|:.||.:....||..|            :....||.||.|       .|..||
Zfish    19 QSANGLGYDASQQQYLQALHAESEYHRP------------ACSLQSPGISAGLHTSNEMSEVCQQ 71

  Fly   331 PHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKP 395
            .:|.      ...::|..|..:.|..|..|..|...         ..:....||...|:..|  |
Zfish    72 INGT------QATVTDTSDNKQPPTAPSGPSSPSSL---------NQIPNIDSAAKNPVHVS--P 119

  Fly   396 IPIPMGHNF--MPSQLQ---------FEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQ 449
            .|....|.|  |....|         ....:.||  ..:.|..:|        .::|.|||:||.
Zfish   120 TPSTRKHIFPWMKESRQNTKQKSCSIISVESCAG--RQKSPPGSA--------ASKRARTAYTSA 174

  Fly   450 QLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            ||:||||:|..|:||.||:|.|:|:.|.|:|.|:||||||||||:|:.:|
Zfish   175 QLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126 12/57 (21%)
Antp-type hexapeptide 127..132 1/4 (25%)
Homeobox 168..220 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..250 1/2 (50%)
DUF4074 347..409 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.