DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxc1a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:246 Identity:68/246 - (27%)
Similarity:91/246 - (36%) Gaps:104/246 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 SSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQG 381
            |.|...||..:..:|.   .||         :.:|.:|:.|:.|..|.          :|...:.
Zfish    65 SKPCEDPGRANSTRPP---FPQ---------NQDFYRPVHPNRPQVPS----------FQSCREQ 107

  Fly   382 GSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARA----GMLHHRIPELAAYP----HHAI--- 435
            |      |...|          |.||...|...:.|    |.:::...|:..|.    |.|:   
Zfish   108 G------LSRKG----------FSPSSDTFRTFSSAHCELGPVNNTQTEVRTYDGPVRHSAVEDD 156

  Fly   436 ---------------LGKT------RR----------------------------------PRTA 445
                           .|||      ||                                  .||.
Zfish   157 NTGHGALNTLNETLHSGKTFEWMRVRRNQSRAAKIQLGKCSDRELKTNHGRDSDEDTSSGGSRTN 221

  Fly   446 FTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR 496
            ||::||.||||:|..||||:|.:|.|:|:.|.||||||||||||||||.|:
Zfish   222 FTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 3/25 (12%)
Homeobox 218..271 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.