DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxc6b

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_005172831.1 Gene:hoxc6b / 58045 ZFINID:ZDB-GENE-000822-1 Length:228 Species:Danio rerio


Alignment Length:206 Identity:59/206 - (28%)
Similarity:90/206 - (43%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 PHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLD--PSG 393
            |:||...|:   |:      :..|...|     |:..::....||.   .|.:.|::..|  ||.
Zfish    39 PYGAAVAQN---RI------YSNPFYSH-----QENVMFGSSRPYD---YGSNMFYQDKDVLPSC 86

  Fly   394 KPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYP------HHAILG---KTRRPRTAFTSQ 449
            :     .|.......|..::.:..|........:..||      .|:.:|   ..||.|..::..
Zfish    87 R-----QGFGQTQGSLTQDYASDQGKTMEPKGSVQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRY 146

  Fly   450 QLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQ-Q 513
            |.|||||:|..|:||:|.:|.|:|:.|.|||.|:||||||||||||:.........:...... |
Zfish   147 QTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQ 211

  Fly   514 QQQQQQTPSAA 524
            ...:::|...|
Zfish   212 DTDKEETGETA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
hoxc6bXP_005172831.1 Homeobox 140..192 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.