DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and msx2a

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001025440.1 Gene:msx2a / 573620 ZFINID:ZDB-GENE-980526-322 Length:257 Species:Danio rerio


Alignment Length:64 Identity:38/64 - (59%)
Similarity:50/64 - (78%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQE 503
            |:|||.||:.|||.||::|:|.:|||..:|.|.:|.|.|:||||||||||||.|.||.::|:.|
Zfish   123 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 34/55 (62%)
msx2aNP_001025440.1 Homeodomain 123..179 CDD:459649 34/55 (62%)

Return to query results.
Submit another query.