DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and meox2a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a / 556898 ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio


Alignment Length:245 Identity:79/245 - (32%)
Similarity:107/245 - (43%) Gaps:48/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 EYDSPSPDGMSRSESPTSSHRSSPPISPG----------CEDQQQPHGALHPQHLSMRMSDFHDE 350
            |:.|..|| :|.|..|::...|..|...|          ...|||.|...|..||: :...:|  
Zfish    30 EHLSSYPD-LSSSSPPSTCIVSGYPGEDGGLFGGHQRGLSVSQQQHHHHHHHHHLA-QQGGWH-- 90

  Fly   351 FKKPIPPHSPIRPQDFPLYAGGHPYQLLAQG---GSAFHRPLDPS--------GKPIP-----IP 399
                :|..|...|.     |.|....|...|   ||:...|..||        |..:|     :|
Zfish    91 ----LPQSSSASPS-----AAGVRLGLGISGPDSGSSDVGPGGPSLCASTPSLGAGVPSGASCVP 146

  Fly   400 MG----HNFMPSQLQFEFLARAGMLHHRIPELAAYPHHA-ILGKTRRPRTAFTSQQLLELEKQFK 459
            .|    |...|::.:    .|.........|.....:.: :..|.|:.|||||.:|:.|||.:|.
Zfish   147 GGDFGRHTMSPAEAE----KRNSKRRSDSSESQDGNYKSDVSSKPRKERTAFTKEQIRELEAEFA 207

  Fly   460 QNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAK 509
            .:.||:|.:|:|:|..|.|:|.|||:|||||||||||.|..||.|..|.|
Zfish   208 HHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAVAREK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 43/101 (43%)
Homeobox 191..243 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.