DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxd1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001016678.1 Gene:hoxd1 / 549432 XenbaseID:XB-GENE-482731 Length:301 Species:Xenopus tropicalis


Alignment Length:263 Identity:74/263 - (28%)
Similarity:93/263 - (35%) Gaps:108/263 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 CEDQQ-----QPH---GALHP-----------QHLSMRMSD------FHDEFKKPIPP------H 358
            |...|     ||:   ||.||           .|.:...|.      ..|...:|.||      |
 Frog    21 CRSDQRNMTLQPYPGSGADHPFMPVGGVPGSVAHQASHQSPALYAPCSLDVAYEPPPPSDYSFLH 85

  Fly   359 SPIRPQDFPLY--------AGGH-PYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFL 414
            |   ..|:..|        .||| ||     |.|.|     |..       |...:..||.:..|
 Frog    86 S---STDYDYYGSNHLVEETGGHIPY-----GSSVF-----PGN-------GSYILNGQLSYRTL 130

  Fly   415 AR------------------AGMLHHRIPELAAYPHHAI------------LGKTRRP------- 442
            ..                  .|.|....|....||..|.            :...|.|       
 Frog   131 GEETQMAQIAQCKEPLEVYPGGNLQSISPSPGTYPKPASPASDTHVSTFDWMKVKRNPPKKSLQS 195

  Fly   443 -----------RTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR 496
                       ||.||::||.||||:|..||||:|.:|.|:|:.|.|::|||||||||||||.|:
 Frog   196 EYGVASPPCTVRTNFTTKQLTELEKEFHFNKYLTRARRIEIANSLQLNDTQVKIWFQNRRMKQKK 260

  Fly   497 SKK 499
            .::
 Frog   261 RER 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/70 (50%)
hoxd1NP_001016678.1 Antp-type hexapeptide. /evidence=ECO:0000255 178..183 0/4 (0%)
Homeobox 207..260 CDD:365835 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..301 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.