DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:196 Identity:61/196 - (31%)
Similarity:82/196 - (41%) Gaps:53/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 PTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPH-----SPIRPQDFPLYA 370
            |..|...|.|:||........:.:.....||           ||.|..     ||...|.||...
 Frog    71 PNLSSEQSQPLSPTANPSSNTNSSSSQASLS-----------KPSPAKSQASGSPASKQIFPWMK 124

  Fly   371 GGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAI 435
            ...      |.......|..|:.:    ..|.:..|                  |..:|      
 Frog   125 ESR------QNSKQKSSPPAPAAE----SCGGDRSP------------------PGSSA------ 155

  Fly   436 LGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKA 500
               ::|.|||:||.||:||||:|..|:||.||:|.|:|:.|.|||.|:||||||||||:|:.:|.
 Frog   156 ---SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKV 217

  Fly   501 Q 501
            :
 Frog   218 K 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 35/51 (69%)
DUF4074 325..384 CDD:315871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.