DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxb7

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:302 Identity:81/302 - (26%)
Similarity:116/302 - (38%) Gaps:112/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LAALHYARDQAELNHAFVTASNAAAAAQAAAS---AAGGISEQEALQRIRDSREYDSPSPDGMSR 307
            :::|:||              ||..:...|||   |.|...||                      
  Rat     1 MSSLYYA--------------NALFSKYPAASSVFAPGAFPEQ---------------------- 29

  Fly   308 SESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGG 372
                ||...:|.|..||       :||                     .|.:|.......||:||
  Rat    30 ----TSCAFASNPQRPG-------YGA---------------------GPGAPFSASVQGLYSGG 62

  Fly   373 HPYQLLAQGGSAFHRP---------LDPSGKPIP-IPMGHNFM------PSQLQFEFLARAGMLH 421
                    ||.|....         |:||...:. .|...|..      |::       .||...
  Rat    63 --------GGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAK-------AAGAKE 112

  Fly   422 HRIPELAA------YPHHAILGKTR-RPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLS 479
            .|..:|||      ||.....|..| |.|..:|..|.|||||:|..|:||:|.:|.|:|..|.|:
  Rat   113 QRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLT 177

  Fly   480 ETQVKIWFQNRRMKWKRSKKAQ---QEAKERAKANQQQQQQQ 518
            |.|:||||||||||||:..|..   ...:::|:|::::::::
  Rat   178 ERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEADEEEEEEE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 2/4 (50%)
Homeobox 141..193 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.