DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxa5

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001011405.1 Gene:hoxa5 / 496880 XenbaseID:XB-GENE-486061 Length:274 Species:Xenopus tropicalis


Alignment Length:274 Identity:76/274 - (27%)
Similarity:103/274 - (37%) Gaps:91/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RLAALHYARDQAELNHAFVTASNA-------AAAAQ----------AAASAAGGISEQEALQRIR 292
            |.|:.|::.:....|:....:|:.       ||:|.          |.|::....|.|.....|.
 Frog    58 RSASNHFSANDRARNYPSNPSSSTEPRYNQPAASAHSPPPDPLPCTAVATSPVSDSHQGGKNSIT 122

  Fly   293 DSREYDSPSPDGMSRSESPTSSH--RSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPI 355
            :|....|.|    |.|.:.||:|  |.....|.|.||..       |.......|   ...:.|.
 Frog   123 NSNNTTSNS----SNSSTGTSTHINRDGLGASSGAEDDA-------PASSDQASS---QNSQSPA 173

  Fly   356 PPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGML 420
            |   .::||.:|                 :.|.|..|...|..|.|                   
 Frog   174 P---SVQPQIYP-----------------WMRKLHISHDNIGGPEG------------------- 199

  Fly   421 HHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKI 485
                               :|.|||:|..|.|||||:|..|:||:|.:|.|:|..|.|||.|:||
 Frog   200 -------------------KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI 245

  Fly   486 WFQNRRMKWKRSKK 499
            ||||||||||:..|
 Frog   246 WFQNRRMKWKKDNK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
hoxa5NP_001011405.1 Homeobox 203..256 CDD:365835 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.