DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and NKX2-2

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:62 Identity:32/62 - (51%)
Similarity:44/62 - (70%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 GKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSK 498
            ||.|:.|..|:..|..|||::|:|.:|||.|:|..:||.:.|:.|||||||||.|.|.||::
Human   126 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRAR 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 28/55 (51%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 3/4 (75%)
Homeodomain 129..185 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.