DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and MEOX1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:265 Identity:74/265 - (27%)
Similarity:106/265 - (40%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 SPSPDGMSRS------ESPTSSHR----------SSPPISPGCEDQQQPHGALHPQHLSMRMSDF 347
            :|..:|...|      .:|.|.|:          :.|..|..|. ...||.....:|:   .::.
Human    24 NPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCL-AATPHSLPQEEHI---FTEQ 84

  Fly   348 HDEFKKPIPPHSPI-----RPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPS 407
            |..|.:....|.|:     ||...|  |||.     .:.|::....:|.:|.|     |.::   
Human    85 HPAFPQSPNWHFPVSDARRRPNSGP--AGGS-----KEMGTSSLGLVDTTGGP-----GDDY--- 134

  Fly   408 QLQFEFLARAGMLHHRIPEL-----------------AAYPHHAILGKTRRPRTAFTSQQLLELE 455
                      |:|.....|.                 ...|..:  .|.|:.|||||.:||.|||
Human   135 ----------GVLGSTANETEKKSSRRRKESSDNQENRGKPEGS--SKARKERTAFTKEQLRELE 187

  Fly   456 KQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQT 520
            .:|..:.||:|.:|:|:|..|.|||.|||:|||||||||||.|..|..:..    .|..:....|
Human   188 AEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPN----GQDPEDGDST 248

  Fly   521 PSAAS 525
            .|.:|
Human   249 ASPSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 32/52 (62%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 22/118 (19%)
Homeobox 175..227 CDD:306543 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.