DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and ftz

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:251 Identity:63/251 - (25%)
Similarity:110/251 - (43%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 AAQAAASAAGGISEQEA---------LQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCE 326
            |...|||....:.|:.:         :::::.:.:|...:.:.:.::.:.::...:||..|    
  Fly    91 AEDDAASIIAAVEERPSTLRALLTNPVKKLKYTPDYFYTTVEQVKKAPAVSTKVTASPAPS---- 151

  Fly   327 DQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDF-PLYAGGHPYQLLAQGGSAFHRPLD 390
                                 :|:....:|..|.....|: .:|:.....|.|..|..|...|..
  Fly   152 ---------------------YDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTT 195

  Fly   391 PSGKPIPIPMGHNFMPSQLQFEFLARA--GMLHHRI---PELAAYPHHAILGKT--------RRP 442
            |:..|   |:.....|.|...|..:.|  ..::|||   |..|...:.:.:.:|        :|.
  Fly   196 PTSLP---PLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRT 257

  Fly   443 RTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSK 498
            |..:|..|.|||||:|..|:|::|.:|.::|:.|.|||.|:||||||||||.|:.:
  Fly   258 RQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 29/52 (56%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 32/184 (17%)
Homeobox 257..310 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.