DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Scr

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:431 Identity:104/431 - (24%)
Similarity:149/431 - (34%) Gaps:130/431 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ANPPGV----PSGAAAPP---PVSPQP-AANHLSHSG---ATMATTTLLPP---------AQSQP 217
            |..||.    |:.||..|   |.:||. .||..::.|   ..|...|.|.|         .|.|.
  Fly    67 AATPGANDYFPAAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQ 131

  Fly   218 KKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGI 282
            :.:....|:.|:.|.|            ||...:.:.|.:...|.::...|........|..||:
  Fly   132 QHAHAAAAVAAQQQQQ------------LAQQQHPQQQQQQQQANISCKYANDPVTPGGSGGGGV 184

  Fly   283 SEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPH--------GALHPQH 339
            |.........:|...:|.|    ..|....|:...||.:||....:....        |:|....
  Fly   185 SGSNNNNNSANSNNNNSQS----LASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAA 245

  Fly   340 LSMRMSDFHD-------EFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIP 397
            .:..:::.|.       .....:|.|||         .||........|..|.......:||..|
  Fly   246 AAAGLNNNHSGSGVSGGPGNVNVPMHSP---------GGGDSDSESDSGNEAGSSQNSGNGKKNP 301

  Fly   398 IPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAIL--------GKTRRPRTAFTSQQLLEL 454
                                       |::..:.....|        |:|:|.||::|..|.|||
  Fly   302 ---------------------------PQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLEL 339

  Fly   455 EKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK-------------------- 499
            ||:|..|:||:|.:|.|:|..|.|:|.|:||||||||||||:..|                    
  Fly   340 EKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQ 404

  Fly   500 --------AQQEAKER-------AKANQQQQQQQQTPSAAS 525
                    |...|.:.       .:.||..|:..||.:|||
  Fly   405 FDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAAS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 31/52 (60%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.