DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and bcd

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:235 Identity:62/235 - (26%)
Similarity:93/235 - (39%) Gaps:67/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPP 357
            |...|..|.|      .:.|..|..|.|         .||...||.|.       |.:.:.|   
  Fly     7 DQNFYHHPLP------HTHTHPHPHSHP---------HPHSHPHPHHQ-------HPQLQLP--- 46

  Fly   358 HSPIRPQDFPLYAGGHPYQLLAQGGSA-----FHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARA 417
                 ||      ..:|:.||....:.     :.||..|:..|.|     :..||:         
  Fly    47 -----PQ------FRNPFDLLFDERTGAINYNYIRPYLPNQMPKP-----DVFPSE--------- 86

  Fly   418 GMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQ 482
                    ||   |...::.:.||.||.|||.|:.|||:.|.|.:||:.|:..::::.|.|...|
  Fly    87 --------EL---PDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQ 140

  Fly   483 VKIWFQNRRMKWK-RSKKAQQEAKERAKANQQQQQQQQTP 521
            |||||:|||.:.| :|.:.:.::.|....:...:|....|
  Fly   141 VKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 25/52 (48%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.