DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and zen

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:139 Identity:57/139 - (41%)
Similarity:74/139 - (53%) Gaps:26/139 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PIPIPMGHNFM---PSQLQFEFLARAGMLHHRIPE------------LAAYPHH-AILGKTRRPR 443
            ||.:|..:|.|   |:.|.          .|..|:            |.:.|:| :...|.:|.|
  Fly    40 PIGLPPNYNQMNSNPTTLN----------DHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSR 94

  Fly   444 TAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERA 508
            |||||.||:|||.:||.|.||.|.:|.|:|..|.|.|.||||||||||||:|:..:..:|.|..|
  Fly    95 TAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNA 159

  Fly   509 KANQQQQQQ 517
            |..|.|.:|
  Fly   160 KLAQPQAEQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.